Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zscan12 Peptide - C-terminal region

Zscan12, zinc finger and SCAN domain containing 12, Zfp96; FPM315; mKIAA0426; 2510038J07Rik; Zscan12, zinc finger and SCAN domain-containing protein 12, zinc finger and SCAN domain-containing protein 12, zfp-96, OTTMUSP00000000442, OTTMUSP00000000443, zinc finger protein 96

Product Specifications

Product Name Alternative

2510038J07Rik, FPM315, Zfp96, mKIAA0426

UniProt

Q9Z1D7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_057893

Preservative

Lyophilized powder

AA Sequence

NSSLATHQETHHKEKPFTQSGPIQQQRNHTKEKPYKCSVCGKAFIQKISL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHKG2 Antibody
orb254171 100 µL

PHKG2 Antibody

Sign In for Pricing
View Details
Trk C (phospho Tyr516) Rabbit Polyclonal Antibody
E28PP0800 100 µL

Trk C (phospho Tyr516) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
pLVX-CMV-AcGFP1-Linker-VAMP8-PGK-Puro Plasmid
PVT33280 2 µg

pLVX-CMV-AcGFP1-Linker-VAMP8-PGK-Puro Plasmid

Sign In for Pricing
View Details
Inhibitor mmu-miR-150-5p AAV miRNA Vector
Amm3014700 500 ng

Inhibitor mmu-miR-150-5p AAV miRNA Vector

Sign In for Pricing
View Details
APOA1BP ELISA Kit (Dog) (OKEH07605)
OKEH07605 96 Well

APOA1BP ELISA Kit (Dog) (OKEH07605)

Sign In for Pricing
View Details
THTPA Protein Vector (Mouse) (pPB-N-His)
PV238219 500 ng

THTPA Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details