Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ID3 Peptide - C-terminal region

ID3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HEIR-1, bHLHb25

UniProt

Q02535

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ID3 Rabbit Polyclonal Antibody (orb573651) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002158

Preservative

Lyophilized powder

AA Sequence

SPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLREL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Bone
CS711881 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details
4-(6-Nitro-3-pyridinyl)-piperazine-2,2,6,6-d4
TRC-N519937-50MG 50 mg

4-(6-Nitro-3-pyridinyl)-piperazine-2,2,6,6-d4

Sign In for Pricing
View Details
Endothelin A Receptor (EDNRA) (NM_001957) Human Over-expression Lysate
LC400727 20 µg

Endothelin A Receptor (EDNRA) (NM_001957) Human Over-expression Lysate

Sign In for Pricing
View Details
alpha Defensin 1 (DEFA1) (+Defensin alpha 3) Goat Polyclonal Antibody
AP23709PU-N 100 µg

alpha Defensin 1 (DEFA1) (+Defensin alpha 3) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Phospholipase A2 IIA (PLA2G2A) (NM_001161727) Human Over-expression Lysate
LC431765 20 µg

Phospholipase A2 IIA (PLA2G2A) (NM_001161727) Human Over-expression Lysate

Sign In for Pricing
View Details
Glutelin Microplate Assay Kit
RDSM183 100 Assays

Glutelin Microplate Assay Kit

Sign In for Pricing
View Details