Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ID3 Peptide - C-terminal region

ID3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HEIR-1, bHLHb25

UniProt

Q02535

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ID3 Rabbit Polyclonal Antibody (orb573651) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002158

Preservative

Lyophilized powder

AA Sequence

SPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLREL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P4HB Human Gene Knockout Kit (CRISPR)
KN202275RB 1 Kit

P4HB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GRF2 (RAPGEF1) Human qPCR Primer Pair (NM_198679)
HP230320 200 Reactions

GRF2 (RAPGEF1) Human qPCR Primer Pair (NM_198679)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS708101 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
rac-1-Palmitoyl-2-linoleoyl-3-chloropropanediol
TRC-P158950-50MG 50 mg

rac-1-Palmitoyl-2-linoleoyl-3-chloropropanediol

Sign In for Pricing
View Details
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), 1mg/mL
BNUM1474-50 1x 50 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), 1mg/mL

Sign In for Pricing
View Details
Recombinant C4.4A/LYPD3 Monoclonal Antibody
AN300244P-01 20 µL

Recombinant C4.4A/LYPD3 Monoclonal Antibody

Sign In for Pricing
View Details