Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRF1 Peptide - N-terminal region

IRF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IRF-1, MAR

UniProt

P10914

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IRF1 Rabbit Polyclonal Antibody (orb576536) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002189

Preservative

Lyophilized powder

AA Sequence

YLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFQ520 Maleimide
#80502 1x 5 mg

CFQ520 Maleimide

Sign In for Pricing
View Details
RSPO1 (NM_001038633) Human Recombinant Protein
TP762458 50 µg

RSPO1 (NM_001038633) Human Recombinant Protein

Sign In for Pricing
View Details
JPT1 (NM_001002033) Human Over-expression Lysate
LY424172 100 µg

JPT1 (NM_001002033) Human Over-expression Lysate

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD242 Polyclonal Antibody
E-AB-15120-01 20 µL

CD242 Polyclonal Antibody

Sign In for Pricing
View Details
CD242 Polyclonal Antibody
E-AB-15120-02 60 µL

CD242 Polyclonal Antibody

Sign In for Pricing
View Details