Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRF1 Peptide - N-terminal region

IRF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IRF-1, MAR

UniProt

P10914

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IRF1 Rabbit Polyclonal Antibody (orb576536) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002189

Preservative

Lyophilized powder

AA Sequence

YLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL28B (IFNL3) activation kit by CRISPRa
GA116962 1 Kit

Human IL28B (IFNL3) activation kit by CRISPRa

Sign In for Pricing
View Details
TMEM9 Human Gene Knockout Kit (CRISPR)
KN400100 1 Kit

TMEM9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,4-Diisopropylbenzene
TRC-D455380-5G 5 g

1,4-Diisopropylbenzene

Sign In for Pricing
View Details
FRZB (NM_001463) Human Over-expression Lysate
LC400569 20 µg

FRZB (NM_001463) Human Over-expression Lysate

Sign In for Pricing
View Details
SPAG1 (NM_003114) Human Recombinant Protein
TP317728 20 µg

SPAG1 (NM_003114) Human Recombinant Protein

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/775), CF405S conjugate, 0.1mg/mL
BNC040775-500 1x 500 µL

Pgp9.5 (UCHL-1) (UCHL1/775), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details