Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eya4 Peptide - middle region

Eya4 Peptide - middle region

Product Specifications

Product Name Alternative

B130023L16Rik

UniProt

Q9Z191

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eya4 Rabbit Polyclonal Antibody (orb330089) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034297

Preservative

Lyophilized powder

AA Sequence

MEDTQDLNEQSVKKTCPEADVSEPQNSRSMEMQDLASPHALVGGSDTPGS

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1562871 3'UTR Lenti-reporter-Luc Vector
39305086 1.0 µg

RGD1562871 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
LMO2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV640522 1.0 µg DNA

LMO2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Cavy Gamma-Aminobutyric Acid Receptor Subunit Alpha-4 (GABRA4) ELISA Kit
MBS9380878 Inquire

Cavy Gamma-Aminobutyric Acid Receptor Subunit Alpha-4 (GABRA4) ELISA Kit

Sign In for Pricing
View Details
DTYMK Rabbit Polyclonal Antibody
TA370327 100 µL

DTYMK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RGD1565987 3'UTR Luciferase Stable Cell Line
TU219273 1.0 mL

RGD1565987 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Streptomyces antibioticus Uncharacterized lipoprotein in oleD 5'region
MBS1381404-01 0.02 mg (E-Coli)

Recombinant Streptomyces antibioticus Uncharacterized lipoprotein in oleD 5'region

Sign In for Pricing
View Details