Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eya4 Peptide - middle region

Eya4 Peptide - middle region

Product Specifications

Product Name Alternative

B130023L16Rik

UniProt

Q9Z191

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eya4 Rabbit Polyclonal Antibody (orb330089) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034297

Preservative

Lyophilized powder

AA Sequence

MEDTQDLNEQSVKKTCPEADVSEPQNSRSMEMQDLASPHALVGGSDTPGS

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3497), CF594 conjugate, 0.1mg/mL
BNC943497-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3497), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KLHL22 Antibody, FITC conjugated
MBS1494057-01 0.05 mg

KLHL22 Antibody, FITC conjugated

Sign In for Pricing
View Details
KLHL22 Antibody, FITC conjugated
MBS1494057-02 0.1 mg

KLHL22 Antibody, FITC conjugated

Sign In for Pricing
View Details
KLHL22 Antibody, FITC conjugated
MBS1494057-03 5x 0.1 mg

KLHL22 Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Rat CD36 / SCARB3 Protein (His tag)
E53A08598 50 µg

Recombinant Rat CD36 / SCARB3 Protein (His tag)

Sign In for Pricing
View Details
Cofilin Mouse mAb
F3226-100uL 100 µL

Cofilin Mouse mAb

Sign In for Pricing
View Details