Ppic Peptide - middle region
Ppic Peptide - middle region
Product Specifications
Product Name Alternative
CyP-20c
UniProt
P30412
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ppic Rabbit Polyclonal Antibody (orb579147) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032934
Preservative
Lyophilized powder
AA Sequence
VVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKIDVKTPFVVEVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BL721 1 Each
Bladder cancer tissue array with normal tissues, 24 cases/72 cores
Sign In for Pricing
View Details MBS1259042-01 0.02 mg (E-Coli)
Recombinant Schizosaccharomyces pombe Septin homolog spn5 (spn5)
Sign In for Pricing
View Details MBS1259042-02 0.02 mg (Yeast)
Recombinant Schizosaccharomyces pombe Septin homolog spn5 (spn5)
Sign In for Pricing
View Details MBS1259042-03 0.1 mg (E-Coli)
Recombinant Schizosaccharomyces pombe Septin homolog spn5 (spn5)
Sign In for Pricing
View Details