Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Megf6 Peptide - N-terminal region

Megf6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Egfl3

UniProt

O88281

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Megf6 Rabbit Polyclonal Antibody (orb579387) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075244

Preservative

Lyophilized powder

AA Sequence

RRGCTSLEESVVDLDGRLPFVRPLPHIAVLRDELPRLFQDDYGAEEEAAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCP3 (NM_003356) Human Over-expression Lysate
LC401147 20 µg

UCP3 (NM_003356) Human Over-expression Lysate

Sign In for Pricing
View Details
MIR4448 Human qPCR Primer Pair (MI0016791)
HP300965 200 Reactions

MIR4448 Human qPCR Primer Pair (MI0016791)

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081M-01 50 Tests

Elab Fluor® 647 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081M-02 100 Tests

Elab Fluor® 647 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
PPAR gamma (PPARG) (NM_015869) Human Over-expression Lysate
LY402467 100 µg

PPAR gamma (PPARG) (NM_015869) Human Over-expression Lysate

Sign In for Pricing
View Details