Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Megf6 Peptide - N-terminal region

Megf6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Egfl3

UniProt

O88281

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Megf6 Rabbit Polyclonal Antibody (orb579387) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075244

Preservative

Lyophilized powder

AA Sequence

RRGCTSLEESVVDLDGRLPFVRPLPHIAVLRDELPRLFQDDYGAEEEAAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCE2 (UBE2F) Human qPCR Primer Pair (NM_080678)
HP216725 200 Reactions

NCE2 (UBE2F) Human qPCR Primer Pair (NM_080678)

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker), CF740 conjugate, 0.1mg/mL
BNC741774-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lewis A (7LE), CF647 conjugate, 0.1mg/mL
BNC470311-100 1x 100 µL

Lewis A (7LE), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS506269 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Betulinic Acid-d3
TRC-B330252-25MG 25 mg

Betulinic Acid-d3

Sign In for Pricing
View Details
MMP3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C12]
TA806978AM 100 µL

MMP3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C12]

Sign In for Pricing
View Details