4732418C07Rik Peptide - C-terminal region
4732418C07Rik Peptide - C-terminal region
Product Specifications
Product Name Alternative
KIAA0494, Kiaa0494, RP23-146I18.2, 4732418C07Rik
UniProt
Q6PCQ6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Efcab14 Rabbit Polyclonal Antibody (orb325311) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_766286
Preservative
Lyophilized powder
AA Sequence
ISALTNKPESNRPPETTDEEQVQNFTSDPSALPEFSQLLRNQIETQVKPL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC700745-500 1x 500 µL
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400146-100 1x 100 µL
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details