Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rngtt Peptide - C-terminal region

Rngtt Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU020997

UniProt

O55236

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rngtt Rabbit Polyclonal Antibody (orb580462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036014

Preservative

Lyophilized powder

AA Sequence

DLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

96 Well ,0.2 mLPCR Plates, Semi Skirted, White, Cuttable
B96HS-02W 0.2 mL

96 Well ,0.2 mLPCR Plates, Semi Skirted, White, Cuttable

Sign In for Pricing
View Details
pCMV-SPORT6-Rab5c Plasmid
PVT59099 2 µg

pCMV-SPORT6-Rab5c Plasmid

Sign In for Pricing
View Details
Reagecon N26 Kinematic Viscosity, Dynamic Viscosity and Density Standard
REVIS-N26 500 mL

Reagecon N26 Kinematic Viscosity, Dynamic Viscosity and Density Standard

Sign In for Pricing
View Details
DBCO-PEG-Amine (MW 5000)
orb3137890-01 10 mg

DBCO-PEG-Amine (MW 5000)

Sign In for Pricing
View Details
DBCO-PEG-Amine (MW 5000)
orb3137890-02 50 mg

DBCO-PEG-Amine (MW 5000)

Sign In for Pricing
View Details
RGD1308612 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7361804 1.0 µg DNA

RGD1308612 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details