Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rngtt Peptide - C-terminal region

Rngtt Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU020997

UniProt

O55236

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rngtt Rabbit Polyclonal Antibody (orb580462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036014

Preservative

Lyophilized powder

AA Sequence

DLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PARC/CCL18 (Pulmonary Activation Regulated Chemokine) ELISA Kit
MBS2515333-01 24 Tests (Limit 1)

Human PARC/CCL18 (Pulmonary Activation Regulated Chemokine) ELISA Kit

Sign In for Pricing
View Details
Human PARC/CCL18 (Pulmonary Activation Regulated Chemokine) ELISA Kit
MBS2515333-02 48 Tests

Human PARC/CCL18 (Pulmonary Activation Regulated Chemokine) ELISA Kit

Sign In for Pricing
View Details
Human PARC/CCL18 (Pulmonary Activation Regulated Chemokine) ELISA Kit
MBS2515333-03 96 Tests

Human PARC/CCL18 (Pulmonary Activation Regulated Chemokine) ELISA Kit

Sign In for Pricing
View Details
Human PARC/CCL18 (Pulmonary Activation Regulated Chemokine) ELISA Kit
MBS2515333-04 5x 96 Tests

Human PARC/CCL18 (Pulmonary Activation Regulated Chemokine) ELISA Kit

Sign In for Pricing
View Details
Human PARC/CCL18 (Pulmonary Activation Regulated Chemokine) ELISA Kit
MBS2515333-05 10x 96 Tests

Human PARC/CCL18 (Pulmonary Activation Regulated Chemokine) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse 9930111J21Rik2 shRNA (UAS) - Lentiviral mouse9930111J21Rik2 shRNA (UAS, GFP) (25)
GTR15207704 1 Vial

Lentiviral mouse 9930111J21Rik2 shRNA (UAS) - Lentiviral mouse9930111J21Rik2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details