Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF835 Peptide - N-terminal region

ZNF835 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BC37295_3

UniProt

Q9Y2P0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF835 Rabbit Polyclonal Antibody (orb581053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001005850

Preservative

Lyophilized powder

AA Sequence

SLAEHRRIHTGEKPYACGQCAKAFTQVSHLTQHQRTHTGERPYPCHDCGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Goat Purified Antibody To Mouse IgG, (Min.x-rxn.),  30nm
GAF-443-30 1 mL

Colloidal Gold Conjugated Goat Purified Antibody To Mouse IgG, (Min.x-rxn.), 30nm

Sign In for Pricing
View Details
CD63 (NKI-C3), CF770 conjugate, 0.1mg/mL
BNC700186-100 1x 100 µL

CD63 (NKI-C3), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Culture Tubes
T8301 1000 Units/Case

Culture Tubes

Sign In for Pricing
View Details
Glucocorticoid Receptor (NR3C1) Mouse Monoclonal Antibody [Clone ID: 6E6]
AM06570SU-N 100 µL

Glucocorticoid Receptor (NR3C1) Mouse Monoclonal Antibody [Clone ID: 6E6]

Sign In for Pricing
View Details
Vmn1r186 Mouse Gene Knockout Kit (CRISPR)
KN518977 1 Kit

Vmn1r186 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HMG20A Polyclonal Antibody
E-AB-61620-01 60 µL

HMG20A Polyclonal Antibody

Sign In for Pricing
View Details