Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF835 Peptide - N-terminal region

ZNF835 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BC37295_3

UniProt

Q9Y2P0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF835 Rabbit Polyclonal Antibody (orb581053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001005850

Preservative

Lyophilized powder

AA Sequence

SLAEHRRIHTGEKPYACGQCAKAFTQVSHLTQHQRTHTGERPYPCHDCGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), 1mg/mL
BNUM2345-50 1x 50 µL

CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), 1mg/mL

Sign In for Pricing
View Details
CDK6 (NM_001259) Human Over-expression Lysate
LY400506 100 µg

CDK6 (NM_001259) Human Over-expression Lysate

Sign In for Pricing
View Details
FHL3 Polyclonal Antibody
E-AB-11238-01 20 µL

FHL3 Polyclonal Antibody

Sign In for Pricing
View Details
FHL3 Polyclonal Antibody
E-AB-11238-02 60 µL

FHL3 Polyclonal Antibody

Sign In for Pricing
View Details
FHL3 Polyclonal Antibody
E-AB-11238-03 120 µL

FHL3 Polyclonal Antibody

Sign In for Pricing
View Details
FHL3 Polyclonal Antibody
E-AB-11238-04 200 µL

FHL3 Polyclonal Antibody

Sign In for Pricing
View Details