Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF311 Peptide - C-terminal region

ZNF311 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Zf31

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF311 Rabbit Polyclonal Antibody (orb325572) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

QDVKLENQWETSIREKLREEKEGSEEVTCKKGKNQKVLSKNLNPNSKHSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL38 (NM_001081675) Human Over-expression Lysate
LY421171 100 µg

KLHL38 (NM_001081675) Human Over-expression Lysate

Sign In for Pricing
View Details
Isopropyl Benzoate
TRC-I874680-500MG 500 mg

Isopropyl Benzoate

Sign In for Pricing
View Details
Phospho-YAP1 (S127) Recombinant Rabbit Monoclonal Antibody [SN0718]
ET1611-69 100 µL

Phospho-YAP1 (S127) Recombinant Rabbit Monoclonal Antibody [SN0718]

Sign In for Pricing
View Details
PRB4 Rabbit Polyclonal Antibody
TA380288 100 µL

PRB4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human AGPAT5 activation kit by CRISPRa
GA110706 1 Kit

Human AGPAT5 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Caspase-3 Antibody
RC-4133-01 50 μL

Recombinant Caspase-3 Antibody

Sign In for Pricing
View Details