Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF311 Peptide - C-terminal region

ZNF311 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Zf31

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF311 Rabbit Polyclonal Antibody (orb325572) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

QDVKLENQWETSIREKLREEKEGSEEVTCKKGKNQKVLSKNLNPNSKHSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plant Flavonoids Colorimetric Assay Kit
E-BC-K284-M-01 48 T (32 samples)

Plant Flavonoids Colorimetric Assay Kit

Sign In for Pricing
View Details
Plant Flavonoids Colorimetric Assay Kit
E-BC-K284-M-02 96 T (80 samples)

Plant Flavonoids Colorimetric Assay Kit

Sign In for Pricing
View Details
RECQ4 (RECQL4) Human Gene Knockout Kit (CRISPR)
KN415399 1 Kit

RECQ4 (RECQL4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UQCRQ Polyclonal Antibody
E-AB-52443-01 20 µL

UQCRQ Polyclonal Antibody

Sign In for Pricing
View Details
UQCRQ Polyclonal Antibody
E-AB-52443-02 60 µL

UQCRQ Polyclonal Antibody

Sign In for Pricing
View Details
UQCRQ Polyclonal Antibody
E-AB-52443-03 120 µL

UQCRQ Polyclonal Antibody

Sign In for Pricing
View Details