Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF20 Peptide - C-terminal region

ZNF20 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ39241, KOX13

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF20 Rabbit Polyclonal Antibody (orb581164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

ECKVCGKAFTCSSSIRYHERTHTGEKPYECKHCGKAFISNYIRYHERTHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZMYND19 (NM_138462) Human Over-expression Lysate
LS116225-100ug 100 µg

ZMYND19 (NM_138462) Human Over-expression Lysate

Sign In for Pricing
View Details
Tetra-decylammonium hydroxide solution
sc-237055 25 mL

Tetra-decylammonium hydroxide solution

Sign In for Pricing
View Details
MMP3 Antibody
A42676-50UG 50 µg

MMP3 Antibody

Sign In for Pricing
View Details
APC/Cyanine7 anti-mouse TNF-α
GT18455 25 µg

APC/Cyanine7 anti-mouse TNF-α

Sign In for Pricing
View Details
SDCCAG3 (ENTR1) (NM_006643) Human Tagged ORF Clone Lentiviral Particle
RC200139L3V 200 µL

SDCCAG3 (ENTR1) (NM_006643) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olr1266 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7359307 1.0 µg DNA

Olr1266 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details