Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF20 Peptide - C-terminal region

ZNF20 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ39241, KOX13

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF20 Rabbit Polyclonal Antibody (orb581164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

ECKVCGKAFTCSSSIRYHERTHTGEKPYECKHCGKAFISNYIRYHERTHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBP1 Antibody
orb673544-01 50 µg

GBP1 Antibody

Sign In for Pricing
View Details
GBP1 Antibody
orb673544-02 100 µg

GBP1 Antibody

Sign In for Pricing
View Details
ABCA10 Rabbit Polyclonal Antibody
TA366881 100 µL

ABCA10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zfp873 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
51167124 3x 1.0µg DNA

Zfp873 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Ent-avibactam sodium
WQA73120-01 5 mg

Ent-avibactam sodium

Sign In for Pricing
View Details
Ent-avibactam sodium
WQA73120-02 10 mg

Ent-avibactam sodium

Sign In for Pricing
View Details