Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF73 Peptide - C-terminal region

ZNF73 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cos12, ZNF186, hZNF2

UniProt

O43830

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036612

Preservative

Lyophilized powder

AA Sequence

QVRQPTCCRKSDFSKHQQTHTGEKPHECVECEKPSISKSDLMIQHKMPTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5ME Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]
TA811780AM 100 µL

ATP5ME Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]

Sign In for Pricing
View Details
Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) ELISA Kit
RDR-GCLM-Hu-01 96 Tests

Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) ELISA Kit

Sign In for Pricing
View Details
Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) ELISA Kit
RDR-GCLM-Hu-02 48 Tests

Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS638360 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
CaMK2β/γ Antibody
8C10992-AAT 50 µg

CaMK2β/γ Antibody

Sign In for Pricing
View Details
ERN1/IRE1 Monoclonal Antibody
AN200216P 100 µL

ERN1/IRE1 Monoclonal Antibody

Sign In for Pricing
View Details