Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF73 Peptide - C-terminal region

ZNF73 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cos12, ZNF186, hZNF2

UniProt

O43830

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036612

Preservative

Lyophilized powder

AA Sequence

QVRQPTCCRKSDFSKHQQTHTGEKPHECVECEKPSISKSDLMIQHKMPTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GAGE12H activation kit by CRISPRa
GA119010 1 Kit

Human GAGE12H activation kit by CRISPRa

Sign In for Pricing
View Details
Rbmxl1 Mouse Gene Knockout Kit (CRISPR)
KN514588 1 Kit

Rbmxl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ass1 Mouse Gene Knockout Kit (CRISPR)
KN501698 1 Kit

Ass1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ACLY Antibody
KC-30108-01 50 μL

ACLY Antibody

Sign In for Pricing
View Details
ACLY Antibody
KC-30108-02 100 µL

ACLY Antibody

Sign In for Pricing
View Details
ACLY Antibody
KC-30108-03 1 mL

ACLY Antibody

Sign In for Pricing
View Details