Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IMPDH1 Peptide - N-terminal region

IMPDH1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp781N0678, IMPD, IMPD1, LCA11, RP10, sWSS2608

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IMPDH1 Rabbit Polyclonal Antibody (orb582304) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

DGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMNA Antibody, Biotin conjugated
CSB-PA013003HD01HU-01 50 μL

LMNA Antibody, Biotin conjugated

Sign In for Pricing
View Details
LMNA Antibody, Biotin conjugated
CSB-PA013003HD01HU-02 100 µL

LMNA Antibody, Biotin conjugated

Sign In for Pricing
View Details
BROMI, NT (Protein Broad-minded, C6orf170, C6orf171) (MaxLight 550)
MBS6466047-01 0.1 mL

BROMI, NT (Protein Broad-minded, C6orf170, C6orf171) (MaxLight 550)

Sign In for Pricing
View Details
BROMI, NT (Protein Broad-minded, C6orf170, C6orf171) (MaxLight 550)
MBS6466047-02 5x 0.1 mL

BROMI, NT (Protein Broad-minded, C6orf170, C6orf171) (MaxLight 550)

Sign In for Pricing
View Details
Anti-CD22 (Moxetumomab pasudotox)-MC-Vc-PAB-MMAE ADC
ADC-W-803 1 mg

Anti-CD22 (Moxetumomab pasudotox)-MC-Vc-PAB-MMAE ADC

Sign In for Pricing
View Details
ATM (N-term) Rabbit pAb
E2620112 100 µL

ATM (N-term) Rabbit pAb

Sign In for Pricing
View Details