IMPDH1 Peptide - N-terminal region
IMPDH1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DKFZp781N0678, IMPD, IMPD1, LCA11, RP10, sWSS2608
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IMPDH1 Rabbit Polyclonal Antibody (orb582304) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
DGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7019682-01 0.02 mg
Recombinant Burkholderia cenocepacia Macrolide export ATP-binding/permease protein MacB (macB)
Sign In for Pricing
View Details MBS7019682-02 0.1 mg
Recombinant Burkholderia cenocepacia Macrolide export ATP-binding/permease protein MacB (macB)
Sign In for Pricing
View Details MBS7019682-03 5x 0.1 mg
Recombinant Burkholderia cenocepacia Macrolide export ATP-binding/permease protein MacB (macB)
Sign In for Pricing
View Details 
abx258775-01 96 Tests
Rat Alpha Hemoglobin Stabilizing Protein (AHSP) ELISA Kit
Sign In for Pricing
View Details