Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phpt1 Peptide - middle region

Phpt1 Peptide - middle region

Product Specifications

Product Name Alternative

1700008C22Rik, Php14

UniProt

Q9DAK9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Phpt1 Rabbit Polyclonal Antibody (orb582576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_083569

Preservative

Lyophilized powder

AA Sequence

DCECLGGGRISHQSQDRKIHVYGYSMGYGRAQHSVSTEKIKAKYPDYEVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOS3 antibody (FITC)
MBS5310345-01 0.1 mg

NOS3 antibody (FITC)

Sign In for Pricing
View Details
NOS3 antibody (FITC)
MBS5310345-02 5x 0.1 mg

NOS3 antibody (FITC)

Sign In for Pricing
View Details
Mmu-miR-218-2-3p miRNA Agomir
orb1918412-01 5 nmol

Mmu-miR-218-2-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-218-2-3p miRNA Agomir
orb1918412-02 10 nmol

Mmu-miR-218-2-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-218-2-3p miRNA Agomir
orb1918412-03 20 nmol

Mmu-miR-218-2-3p miRNA Agomir

Sign In for Pricing
View Details
Na+ CP type α-pan Rabbit Polyclonal Antibody
ES7124-01 50 µL

Na+ CP type α-pan Rabbit Polyclonal Antibody

Sign In for Pricing
View Details