Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phpt1 Peptide - middle region

Phpt1 Peptide - middle region

Product Specifications

Product Name Alternative

1700008C22Rik, Php14

UniProt

Q9DAK9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Phpt1 Rabbit Polyclonal Antibody (orb582576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_083569

Preservative

Lyophilized powder

AA Sequence

DCECLGGGRISHQSQDRKIHVYGYSMGYGRAQHSVSTEKIKAKYPDYEVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORD79 siRNA Oligos set (Human)
44928171 3x 5 nmol

SNORD79 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant Human Kallikrein 3/PSA CF
1344-SE-010 10 µg

Recombinant Human Kallikrein 3/PSA CF

Sign In for Pricing
View Details
Recombinant Human USP37 Protein, N-His
E55P7902 50 µg

Recombinant Human USP37 Protein, N-His

Sign In for Pricing
View Details
Sheep Ubiquitin Cross Reactive Protein ELISA Kit
MBS048722-01 48 Well

Sheep Ubiquitin Cross Reactive Protein ELISA Kit

Sign In for Pricing
View Details
Sheep Ubiquitin Cross Reactive Protein ELISA Kit
MBS048722-02 96 Well

Sheep Ubiquitin Cross Reactive Protein ELISA Kit

Sign In for Pricing
View Details
Sheep Ubiquitin Cross Reactive Protein ELISA Kit
MBS048722-03 5x 96 Well

Sheep Ubiquitin Cross Reactive Protein ELISA Kit

Sign In for Pricing
View Details