Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rprml Peptide - N-terminal region

Rprml Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW049332

UniProt

Q3URD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rprml Rabbit Polyclonal Antibody (orb326060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001028384

Preservative

Lyophilized powder

AA Sequence

PLTASDGVPAGLAPDERSLWVSRVAQIAVLCVLSLTVVFGVFFLGCNLLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-human CD5 mAb
E4A09C23 50 µg

Human anti-human CD5 mAb

Sign In for Pricing
View Details
Lithium Hydroxide
40100319-2 1 kg

Lithium Hydroxide

Sign In for Pricing
View Details
SMPDL3A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV679180 1.0 µg DNA

SMPDL3A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
MAP3K5 (T842) Rabbit pAb
E2620102 100 µL

MAP3K5 (T842) Rabbit pAb

Sign In for Pricing
View Details
Isosinensetin, 3',4' ,5,7,8-pentamethoxyflavone
orb105832 20 mg

Isosinensetin, 3',4' ,5,7,8-pentamethoxyflavone

Sign In for Pricing
View Details
Ethyl (1H-pyrazol-1-yl) acetate
sc-263118A 5 g

Ethyl (1H-pyrazol-1-yl) acetate

Sign In for Pricing
View Details