Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rprml Peptide - N-terminal region

Rprml Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW049332

UniProt

Q3URD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rprml Rabbit Polyclonal Antibody (orb326060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001028384

Preservative

Lyophilized powder

AA Sequence

PLTASDGVPAGLAPDERSLWVSRVAQIAVLCVLSLTVVFGVFFLGCNLLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JEV Monoclonal Antibody
VAnt-Wyb236 Each

JEV Monoclonal Antibody

Sign In for Pricing
View Details
Bhlha9 Rabbit Polyclonal Antibody
TA329615 100 µL

Bhlha9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR52Q1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV739249 1.0 µg DNA

OR52Q1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
2-(4-(4-(4-Chlorobutoxy)butyl)piperazin-1-yl)pyrimidine
TRC-C868540-100MG 100 mg

2-(4-(4-(4-Chlorobutoxy)butyl)piperazin-1-yl)pyrimidine

Sign In for Pricing
View Details
CaiB Antibody
orb810614 2 mg

CaiB Antibody

Sign In for Pricing
View Details
Mouse Neuronal migration protein doublecortin (DCX) ELISA Kit
AE47691MO-01 48 Tests

Mouse Neuronal migration protein doublecortin (DCX) ELISA Kit

Sign In for Pricing
View Details