Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ntf3 Peptide - N-terminal region

Ntf3 Peptide - N-terminal region

Product Specifications

UniProt

P18280

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ntf3 Rabbit Polyclonal Antibody (orb583130) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_112335

Preservative

Lyophilized powder

AA Sequence

LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P4ha2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3654903 1.0 µg DNA

P4ha2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
IST1 Antibody
orb620553 100 µL

IST1 Antibody

Sign In for Pricing
View Details
Cytokeratin 6/75 (H-6) Alexa Fluor® 488
sc-166074 AF488 200 µg/mL

Cytokeratin 6/75 (H-6) Alexa Fluor® 488

Sign In for Pricing
View Details
SLC44A2 Antibody - middle region : HRP (ARP44009_P050-HRP)
ARP44009_P050-HRP 100 µL

SLC44A2 Antibody - middle region : HRP (ARP44009_P050-HRP)

Sign In for Pricing
View Details
GENLISA Norovirus Antibody ELISA
KBVH251 1x 96 Well

GENLISA Norovirus Antibody ELISA

Sign In for Pricing
View Details
Anti-GFP-tag Antibody - AcalephFluor790
CSA5413-01 30 µL

Anti-GFP-tag Antibody - AcalephFluor790

Sign In for Pricing
View Details