Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ntf3 Peptide - N-terminal region

Ntf3 Peptide - N-terminal region

Product Specifications

UniProt

P18280

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ntf3 Rabbit Polyclonal Antibody (orb583130) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_112335

Preservative

Lyophilized powder

AA Sequence

LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpr161 siRNA Oligos set (Mouse)
22526174 3x 5 nmol

Gpr161 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Recombinant Human SULF1 Protein
E30P542 20 µg

Recombinant Human SULF1 Protein

Sign In for Pricing
View Details
Anti-CD340/ERBB2/HER2/NEU (ADCT-502) Biosimilar (Monoclonal, IgG)
A136325 100 µL

Anti-CD340/ERBB2/HER2/NEU (ADCT-502) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details
Recombinant Human ERK3/MAPK12 Protein
PKSH030317 50 µg

Recombinant Human ERK3/MAPK12 Protein

Sign In for Pricing
View Details
Sodium 2-chloro-5-fluorobenzoate
PC49057-01 5 g

Sodium 2-chloro-5-fluorobenzoate

Sign In for Pricing
View Details
Sodium 2-chloro-5-fluorobenzoate
PC49057-02 25 g

Sodium 2-chloro-5-fluorobenzoate

Sign In for Pricing
View Details