Vat1l Peptide - N-terminal region
Vat1l Peptide - N-terminal region
Product Specifications
Product Name Alternative
9430073I07, AI427515, mKIAA1576
UniProt
Q80TB8
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Vat1l Rabbit Polyclonal Antibody (orb583579) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_766604
Preservative
Lyophilized powder
AA Sequence
FIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880050-100 1x 100 µL
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042216-100 1x 100 µL
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400050-500 1x 500 µL
IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
