Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sav1 Peptide - N-terminal region

Sav1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700040G09Rik, Sav, WW45, Wwp3, Wwp4

UniProt

Q8VEB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sav1 Rabbit Polyclonal Antibody (orb330929) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_071311

Preservative

Lyophilized powder

AA Sequence

PCAPSVPRYDQPPPITYQPQQTERNQSLLVPANPYHTAEIPDWLQVYARA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM183AP1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2404003 1.0 µg DNA

TMEM183AP1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
TRNAA31 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV751159 1.0 µg DNA

TRNAA31 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
pCMV-EGFP-EHD3-Neo Plasmid
PVT47811 2 µg

pCMV-EGFP-EHD3-Neo Plasmid

Sign In for Pricing
View Details
TFEB Human shRNA Plasmid Kit (Locus ID 7942)
TF308867 1 Kit

TFEB Human shRNA Plasmid Kit (Locus ID 7942)

Sign In for Pricing
View Details
LENG1 (NM_024316) Human Mass Spec Standard
PH304931 10 µg

LENG1 (NM_024316) Human Mass Spec Standard

Sign In for Pricing
View Details
Mouse Monoclonal ER beta/NR3A2 Antibody (ESR2/686) [DyLight 350]
NBP2-47797UV 0.1 mL

Mouse Monoclonal ER beta/NR3A2 Antibody (ESR2/686) [DyLight 350]

Sign In for Pricing
View Details