Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sav1 Peptide - N-terminal region

Sav1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700040G09Rik, Sav, WW45, Wwp3, Wwp4

UniProt

Q8VEB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sav1 Rabbit Polyclonal Antibody (orb330929) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_071311

Preservative

Lyophilized powder

AA Sequence

PCAPSVPRYDQPPPITYQPQQTERNQSLLVPANPYHTAEIPDWLQVYARA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL21P45 siRNA Oligos set (Human)
41048171 3x 5 nmol

RPL21P45 siRNA Oligos set (Human)

Sign In for Pricing
View Details
TRIM52 (NM_032765) Human Over-expression Lysate
E45H12944-2 20 µg

TRIM52 (NM_032765) Human Over-expression Lysate

Sign In for Pricing
View Details
TLCD1 (NM_001160407) Human Over-expression Lysate
E45H01157-2 20 µg

TLCD1 (NM_001160407) Human Over-expression Lysate

Sign In for Pricing
View Details
Slc35g3 Protein Vector (Human) (pPM-C-HA)
PV129900 500 ng

Slc35g3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Camk1g Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-1809R-BF350 100 µL

Camk1g Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Recombinant Macacaf scicularis Erythropoietin receptor (EPOR), partial
CSB-MP3538MOV-01 10 µg

Recombinant Macacaf scicularis Erythropoietin receptor (EPOR), partial

Sign In for Pricing
View Details