Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sav1 Peptide - N-terminal region

Sav1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700040G09Rik, Sav, WW45, Wwp3, Wwp4

UniProt

Q8VEB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sav1 Rabbit Polyclonal Antibody (orb330929) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_071311

Preservative

Lyophilized powder

AA Sequence

PCAPSVPRYDQPPPITYQPQQTERNQSLLVPANPYHTAEIPDWLQVYARA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant DENV-1 Envelope protein E Protein, C-His
VK589021-01 50 µg

Recombinant DENV-1 Envelope protein E Protein, C-His

Sign In for Pricing
View Details
Recombinant DENV-1 Envelope protein E Protein, C-His
VK589021-02 100 µg

Recombinant DENV-1 Envelope protein E Protein, C-His

Sign In for Pricing
View Details
Recombinant DENV-1 Envelope protein E Protein, C-His
VK589021-03 1 mg

Recombinant DENV-1 Envelope protein E Protein, C-His

Sign In for Pricing
View Details
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone 3H5]
E45M14002V-2 50 µL

GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone 3H5]

Sign In for Pricing
View Details
Pih1d2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6553807 1.0 µg DNA

Pih1d2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF594 conjugate, 0.1mg/mL
BNC941564-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details