Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nap1l2 Peptide - C-terminal region

Nap1l2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Bpx

UniProt

P51860

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nap1l2 Rabbit Polyclonal Antibody (orb583619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_032697

Preservative

Lyophilized powder

AA Sequence

QTRAAHLESKFLREFHDIERKFAEMYQPLLEKRRQIINAVYEPTEEECEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flocoumafen-d4
TRC-F401502-5MG 5 mg

Flocoumafen-d4

Sign In for Pricing
View Details
CD20 (MS4A1) Human Gene Knockout Kit (CRISPR)
KN201242LP 1 Kit

CD20 (MS4A1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3,4'-Diacetyldiphenyl Oxide
TRC-D754250-500MG 500 mg

3,4'-Diacetyldiphenyl Oxide

Sign In for Pricing
View Details
ZNF690 / ZSCAN29 (ZSCAN29/2610), CF640R conjugate, 0.1mg/mL
BNC402610-100 1x 100 µL

ZNF690 / ZSCAN29 (ZSCAN29/2610), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sesn3 Mouse Gene Knockout Kit (CRISPR)
KN515619 1 Kit

Sesn3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (rTP53/1739), CF568 conjugate, 0.1mg/mL
BNC682091-100 1x 100 µL

P53 Tumor Suppressor Protein (rTP53/1739), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details