Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nap1l2 Peptide - C-terminal region

Nap1l2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Bpx

UniProt

P51860

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nap1l2 Rabbit Polyclonal Antibody (orb583619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_032697

Preservative

Lyophilized powder

AA Sequence

QTRAAHLESKFLREFHDIERKFAEMYQPLLEKRRQIINAVYEPTEEECEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1-acetyl-2,3-dihydro-1H-indol-5-yl)boronic Acid
TRC-A165865-50MG 50 mg

(1-acetyl-2,3-dihydro-1H-indol-5-yl)boronic Acid

Sign In for Pricing
View Details
Faropenem Sodium Salt Hemipentahydrate
TRC-F103300-5MG 5 mg

Faropenem Sodium Salt Hemipentahydrate

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (rCELA3B/1811), CF568 conjugate, 0.1mg/mL
BNC683435-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (rCELA3B/1811), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Cocktail PAN-CK), CF405S conjugate, 0.1mg/mL
BNC040999-100 1x 100 µL

Cytokeratin, pan (Cocktail PAN-CK), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Primer Panel
HPP6019B 10x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details
MCK10 (DDR1) Human Gene Knockout Kit (CRISPR)
KN201224BN 1 Kit

MCK10 (DDR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details