Lhpp Peptide - middle region
Lhpp Peptide - middle region
Product Specifications
Product Name Alternative
2310007H09Rik
UniProt
Q9D7I5
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Lhpp Rabbit Polyclonal Antibody (orb326218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_083885
Preservative
Lyophilized powder
AA Sequence
VGDVGGAQQCGMRALQVRTGKFRPGDEHHPEVQADGYVDNLAEAVDLLLK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![6-FAM, SE [6-Carboxyfluorescein, succinimidyl ester] *CAS 92557-81-8*](https://cdn.genprice.uk/products/271/7358466/imageurl/116-aat.webp)
116-AAT 10 mg
6-FAM, SE [6-Carboxyfluorescein, succinimidyl ester] *CAS 92557-81-8*
Sign In for Pricing
View Details 
67900 50 Preparations
Synovial Fluid Bacterial Genomic DNA Isolation Kit
Sign In for Pricing
View Details 
BNC040689-100 1x 100 µL
Cytokeratin 8 (K8.8), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 