Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lhpp Peptide - middle region

Lhpp Peptide - middle region

Product Specifications

Product Name Alternative

2310007H09Rik

UniProt

Q9D7I5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lhpp Rabbit Polyclonal Antibody (orb326218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_083885

Preservative

Lyophilized powder

AA Sequence

VGDVGGAQQCGMRALQVRTGKFRPGDEHHPEVQADGYVDNLAEAVDLLLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TSLP Recombinant Rabbit monoclonal Antibody
HA723488 100 µL

Human TSLP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1475), CF647 conjugate, 0.1mg/mL
BNC473433-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1475), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Amino-2-chlorobenzoic Acid
TRC-A603270-25G 25 g

4-Amino-2-chlorobenzoic Acid

Sign In for Pricing
View Details
UBE2D2 Polyclonal Antibody
E-AB-90252-01 60 µL

UBE2D2 Polyclonal Antibody

Sign In for Pricing
View Details
UBE2D2 Polyclonal Antibody
E-AB-90252-02 120 µL

UBE2D2 Polyclonal Antibody

Sign In for Pricing
View Details
UBE2D2 Polyclonal Antibody
E-AB-90252-03 200 µL

UBE2D2 Polyclonal Antibody

Sign In for Pricing
View Details