Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab17 Peptide - C-terminal region

Rab17 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1562478

UniProt

B2RZ46

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab17 Rabbit Polyclonal Antibody (orb330934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001102833

Preservative

Lyophilized powder

AA Sequence

HPGEVVVMLVGNKTDLGEEREVTFQEGKEFAESKSLLFMESSAKLNYQVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS2 ELISA Kit (Human)
OKEH08324-96W 96 Tests

RGS2 ELISA Kit (Human)

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. indica (Rice) OsI_22263 Polyclonal Antibody
MBS7167942 Inquire

Rabbit anti-Oryza sativa subsp. indica (Rice) OsI_22263 Polyclonal Antibody

Sign In for Pricing
View Details
Pericentrin Recombinant Protein Antigen
NBP1-87772PEP 0.1 mL

Pericentrin Recombinant Protein Antigen

Sign In for Pricing
View Details
FNIP1 Antibody - middle region
MBS3221177-01 0.1 mL

FNIP1 Antibody - middle region

Sign In for Pricing
View Details
FNIP1 Antibody - middle region
MBS3221177-02 5x 0.1 mL

FNIP1 Antibody - middle region

Sign In for Pricing
View Details
AF 4 Polyclonal Antibody, PE Conjugated
bs-5958R-PE 100 µL

AF 4 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details