Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab17 Peptide - C-terminal region

Rab17 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1562478

UniProt

B2RZ46

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab17 Rabbit Polyclonal Antibody (orb330934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001102833

Preservative

Lyophilized powder

AA Sequence

HPGEVVVMLVGNKTDLGEEREVTFQEGKEFAESKSLLFMESSAKLNYQVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF71 sgRNA CRISPR Lentivector set (Human)
K2684401 3x 1.0 µg

ZNF71 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Triamyl phosphite
T17745-01 1 g

Triamyl phosphite

Sign In for Pricing
View Details
Triamyl phosphite
T17745-02 5 g

Triamyl phosphite

Sign In for Pricing
View Details
Triamyl phosphite
T17745-03 25 g

Triamyl phosphite

Sign In for Pricing
View Details
KCTD14 Mouse Monoclonal Antibody [Clone ID: OTI3F5]
CF502636 100 µg

KCTD14 Mouse Monoclonal Antibody [Clone ID: OTI3F5]

Sign In for Pricing
View Details
Crystallin Alpha B (CRYAB) Antibody
abx015733 100 µL

Crystallin Alpha B (CRYAB) Antibody

Sign In for Pricing
View Details