Klf15 Peptide - N-terminal region
Klf15 Peptide - N-terminal region
Product Specifications
Product Name Alternative
1810013I09Rik, AV048136, AW494632, CKLF, KKLF
UniProt
Q9EPW2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Klf15 Rabbit Polyclonal Antibody (orb330954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_075673
Preservative
Lyophilized powder
AA Sequence
MVDHLLPVDETFSSPKCSVGYLGDRLASRQPYHMLPSPISEDDSDVSSPC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC551037-500 1x 500 µL
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details