Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nap1l4 Peptide - N-terminal region

Nap1l4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2810410H14Rik, AI316776, D7Wsu30e, Nap2

UniProt

Q78ZA7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nap1l4 Rabbit Polyclonal Antibody (orb583950) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_032698

Preservative

Lyophilized powder

AA Sequence

HDLERKYAALYQPLFDKRREFITGDVEPTDAESAWHSENEEEDKLAGDMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRCOL1 Human Gene Knockout Kit (CRISPR)
KN431002 1 Kit

LRCOL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PRDM1 (NM_001198) Human Over-expression Lysate
LY400479 100 µg

PRDM1 (NM_001198) Human Over-expression Lysate

Sign In for Pricing
View Details
5-Chloro-1-(4-fluorophenyl)indole
TRC-C366370-250MG 250 mg

5-Chloro-1-(4-fluorophenyl)indole

Sign In for Pricing
View Details
RAB4B (NM_016154) Human Recombinant Protein
TP308302L 1 mg

RAB4B (NM_016154) Human Recombinant Protein

Sign In for Pricing
View Details
ICOS-L / ICOS Ligand / B7RP-1 (Immuno-Oncology Target) (ICOSL/3111), CF647 conjugate, 0.1mg/mL
BNC473111-100 1x 100 µL

ICOS-L / ICOS Ligand / B7RP-1 (Immuno-Oncology Target) (ICOSL/3111), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112T3-01 50 Tests

Elab Fluor® Violet 540 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details