GTPBP5 Peptide - C-terminal region
GTPBP5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ10741, MGC29512, ObgH1, dJ1005F21.2
UniProt
Q9H4K7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GTPBP5 Rabbit Polyclonal Antibody (orb585436) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_056481
Preservative
Lyophilized powder
AA Sequence
SRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683134-500 1x 500 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/3134R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC419270 20 µg
CD73 (NT5E) (NM_002526) Human Over-expression Lysate
Sign In for Pricing
View Details ![delta Sarcoglycan (SGCD) Mouse Monoclonal Antibody [Clone ID: AT19G8]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd98d/imageurl/am50079pu-s.webp)
AM50079PU-S 50 µL
delta Sarcoglycan (SGCD) Mouse Monoclonal Antibody [Clone ID: AT19G8]
Sign In for Pricing
View Details 