Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTPBP5 Peptide - C-terminal region

GTPBP5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ10741, MGC29512, ObgH1, dJ1005F21.2

UniProt

Q9H4K7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GTPBP5 Rabbit Polyclonal Antibody (orb585436) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056481

Preservative

Lyophilized powder

AA Sequence

SRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATAD2 Human Gene Knockout Kit (CRISPR)
KN418291 1 Kit

ATAD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TPD52L1 (NM_001003396) Human Over-expression Lysate
LY424123 100 µg

TPD52L1 (NM_001003396) Human Over-expression Lysate

Sign In for Pricing
View Details
Sulfadoxine
TRC-S699070-10G 10 g

Sulfadoxine

Sign In for Pricing
View Details
Dibutylated Hydroxyanisole-d20
TRC-B690372-5MG 5 mg

Dibutylated Hydroxyanisole-d20

Sign In for Pricing
View Details
Rnls Mouse Gene Knockout Kit (CRISPR)
KN514966 1 Kit

Rnls Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GM13125 Polyclonal Antibody
E-AB-90436-01 60 µL

GM13125 Polyclonal Antibody

Sign In for Pricing
View Details