Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB10 Peptide - C-terminal region

NDUFB10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PDSW

UniProt

O96000

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFB10 Rabbit Polyclonal Antibody (orb585455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004539

Preservative

Lyophilized powder

AA Sequence

KVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A SH
HA12516004.0.5G 5 g

Polystyrene A SH

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD22 Antibody[Cy34.1]
E-AB-F1021UG-01 25 µg

PE/Cyanine5 Anti-Mouse CD22 Antibody[Cy34.1]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD22 Antibody[Cy34.1]
E-AB-F1021UG-02 100 µg

PE/Cyanine5 Anti-Mouse CD22 Antibody[Cy34.1]

Sign In for Pricing
View Details
Cytochrome P450 3A7 Antibody
8C21003-AAT 50 µg

Cytochrome P450 3A7 Antibody

Sign In for Pricing
View Details
RECQ1 (RECQL) (NM_002907) Human Over-expression Lysate
LY419011 100 µg

RECQ1 (RECQL) (NM_002907) Human Over-expression Lysate

Sign In for Pricing
View Details
(±)5,6-DiHETE Lactone
TRC-D451678-1MG 1 mg

(±)5,6-DiHETE Lactone

Sign In for Pricing
View Details