Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLCXD1 Peptide - C-terminal region

PLCXD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ11323

UniProt

Q9NUJ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLCXD1 Rabbit Polyclonal Antibody (orb585459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_060860

Preservative

Lyophilized powder

AA Sequence

YWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Antithrombin (AT)
MBS2064846-01 0.1 mL

APC-Linked Polyclonal Antibody to Antithrombin (AT)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Antithrombin (AT)
MBS2064846-02 0.2 mL

APC-Linked Polyclonal Antibody to Antithrombin (AT)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Antithrombin (AT)
MBS2064846-03 0.5 mL

APC-Linked Polyclonal Antibody to Antithrombin (AT)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Antithrombin (AT)
MBS2064846-04 1 mL

APC-Linked Polyclonal Antibody to Antithrombin (AT)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Antithrombin (AT)
MBS2064846-05 5 mL

APC-Linked Polyclonal Antibody to Antithrombin (AT)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Antithrombin (AT)
MBS2064846-06 5x 5 mL

APC-Linked Polyclonal Antibody to Antithrombin (AT)

Sign In for Pricing
View Details