Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTLL3 Peptide - C-terminal region

TTLL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp434B103, DKFZp686D076, FLJ13898, HOTTL, MGC120529, MGC120530, MGC120532

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTLL3 Rabbit Polyclonal Antibody (orb326453) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

APVGRSRPKANSRPDCDKPRAEACPMKRLSPLKPLPLVGTFQRRRGLGDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1193 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV636111 1.0 µg DNA

Olr1193 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
X Recombinant Protein
OPCA03509-1MG 1 mg

X Recombinant Protein

Sign In for Pricing
View Details
Lentiviral mouse Fbxl22 shRNA (UAS) - Lentiviral mouse Fbxl22 shRNA (UAS, GFP) (100)
GTR15271977 1 Vial

Lentiviral mouse Fbxl22 shRNA (UAS) - Lentiviral mouse Fbxl22 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
CASC3 HDR Plasmid (m)
sc-431387-HDR 20 µg

CASC3 HDR Plasmid (m)

Sign In for Pricing
View Details
Benzyl 4-Phenylbutanoate
442487-01 1 g

Benzyl 4-Phenylbutanoate

Sign In for Pricing
View Details
Benzyl 4-Phenylbutanoate
442487-02 2.5 g

Benzyl 4-Phenylbutanoate

Sign In for Pricing
View Details