Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTLL3 Peptide - C-terminal region

TTLL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp434B103, DKFZp686D076, FLJ13898, HOTTL, MGC120529, MGC120530, MGC120532

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTLL3 Rabbit Polyclonal Antibody (orb326453) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

APVGRSRPKANSRPDCDKPRAEACPMKRLSPLKPLPLVGTFQRRRGLGDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (AP)
MBS6162977-01 0.1 mL

HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (AP)

Sign In for Pricing
View Details
HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (AP)
MBS6162977-02 5x 0.1 mL

HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (AP)

Sign In for Pricing
View Details
Ribavirin 5'-monophosphate sodium salt
NR46024 2 mg

Ribavirin 5'-monophosphate sodium salt

Sign In for Pricing
View Details
Selenium Binding Protein 1 Antibody
bs-4200R 100 µL

Selenium Binding Protein 1 Antibody

Sign In for Pricing
View Details
CSRP1 (Cysteine And Glycine-rich Protein 1, Cysteine-rich Protein 1, CRP1, CRP, CSRP, CYRP) (MaxLight 550)
MBS6209733-01 0.1 mL

CSRP1 (Cysteine And Glycine-rich Protein 1, Cysteine-rich Protein 1, CRP1, CRP, CSRP, CYRP) (MaxLight 550)

Sign In for Pricing
View Details
CSRP1 (Cysteine And Glycine-rich Protein 1, Cysteine-rich Protein 1, CRP1, CRP, CSRP, CYRP) (MaxLight 550)
MBS6209733-02 5x 0.1 mL

CSRP1 (Cysteine And Glycine-rich Protein 1, Cysteine-rich Protein 1, CRP1, CRP, CSRP, CYRP) (MaxLight 550)

Sign In for Pricing
View Details