Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHBG Peptide - C-terminal region

SHBG Peptide - C-terminal region

Product Specifications

Product Name Alternative

ABP, MGC126834, MGC138391, SBP, TEBG

UniProt

E9PGW1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHBG Rabbit Polyclonal Antibody (orb585495) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001139753

Preservative

Lyophilized powder

AA Sequence

RGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pten (NM_008960) Mouse Tagged Lenti ORF Clone
MR206321L1 10 µg

Pten (NM_008960) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ggnbp2 (m) -PR
sc-145389-PR 10 µM - 20 µL

Ggnbp2 (m) -PR

Sign In for Pricing
View Details
Aldoart1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3241206 1.0 µg DNA

Aldoart1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rat cluster Of differentiation 4, CD4 ELISA Kit
CK-bio-14395-01 48 Tests

Rat cluster Of differentiation 4, CD4 ELISA Kit

Sign In for Pricing
View Details
Rat cluster Of differentiation 4, CD4 ELISA Kit
CK-bio-14395-02 96 Tests

Rat cluster Of differentiation 4, CD4 ELISA Kit

Sign In for Pricing
View Details
Rat cluster Of differentiation 4, CD4 ELISA Kit
CK-bio-14395-03 5x 96 Tests

Rat cluster Of differentiation 4, CD4 ELISA Kit

Sign In for Pricing
View Details