Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHBG Peptide - C-terminal region

SHBG Peptide - C-terminal region

Product Specifications

Product Name Alternative

ABP, MGC126834, MGC138391, SBP, TEBG

UniProt

E9PGW1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHBG Rabbit Polyclonal Antibody (orb585495) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001139753

Preservative

Lyophilized powder

AA Sequence

RGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-INI-1 antibody
STJ180136 0.1 ml

Anti-INI-1 antibody

Sign In for Pricing
View Details
LRRC48 (DRC3) (NM_031294) Human Over-expression Lysate
LC410568 20 µg

LRRC48 (DRC3) (NM_031294) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-SERINC3 Antibody Picoband® (Dylight488 Conjugate)
A05936-2-Dylight488 100 µg

Anti-SERINC3 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
hsa-miR-20a-3p miRNA Inhibitor
MIH01528 2x 5.0 nmol

hsa-miR-20a-3p miRNA Inhibitor

Sign In for Pricing
View Details
SULT6B1 (NM_001032377) Human Over-expression Lysate
LS391365 100 µg

SULT6B1 (NM_001032377) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Burkholderia thailandensis Chaperone surA (surA)
MBS1415319-01 0.02 mg (E-Coli)

Recombinant Burkholderia thailandensis Chaperone surA (surA)

Sign In for Pricing
View Details