Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGP Peptide - N-terminal region

PGP Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC4692

UniProt

A6NDG6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGP Rabbit Polyclonal Antibody (orb585502) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001035830

Preservative

Lyophilized powder

AA Sequence

TDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TGOLN2 Protein Lysate
MBS8428494-01 0.02 mg

Human TGOLN2 Protein Lysate

Sign In for Pricing
View Details
Human TGOLN2 Protein Lysate
MBS8428494-02 5x 0.02 mg

Human TGOLN2 Protein Lysate

Sign In for Pricing
View Details
PS-1 Polyclonal Antibody
ABP55849-01 30 µL

PS-1 Polyclonal Antibody

Sign In for Pricing
View Details
PS-1 Polyclonal Antibody
ABP55849-02 100 µL

PS-1 Polyclonal Antibody

Sign In for Pricing
View Details
PS-1 Polyclonal Antibody
ABP55849-03 200 µL

PS-1 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human GPR26 shRNA (UAS) - Lentiviral human GPR26 shRNA (UAS) (100)
GTR15348069 1 Vial

Lentiviral human GPR26 shRNA (UAS) - Lentiviral human GPR26 shRNA (UAS) (100)

Sign In for Pricing
View Details