Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGD Peptide - N-terminal region

PGD Peptide - N-terminal region

Product Specifications

Product Name Alternative

6PGD

UniProt

P52209

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGD Rabbit Polyclonal Antibody (orb585508) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002622

Preservative

Lyophilized powder

AA Sequence

DFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NR1I2 Knockout HEK293T cell line
GTR15402056 1 Vial

Human NR1I2 Knockout HEK293T cell line

Sign In for Pricing
View Details
PIAS3 Human Gene Knockout Kit (CRISPR)
KN407034 1 Kit

PIAS3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Citric Acid Anhydrous 99.5% AR
82100500 500 mg

Citric Acid Anhydrous 99.5% AR

Sign In for Pricing
View Details
Human CD163 MAb (Clone 1084111)
MAB11580-100 100 µg

Human CD163 MAb (Clone 1084111)

Sign In for Pricing
View Details
125-500 mL single-use bottle cap (NG)
BIOBGCBP382003 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

125-500 mL single-use bottle cap (NG)

Sign In for Pricing
View Details
CD305 (Leukocyte-associated Immunoglobulin-like Receptor 1, LAIR1, LAIR-1, hLAIR1) (FITC)
MBS6146354-01 0.1 mL

CD305 (Leukocyte-associated Immunoglobulin-like Receptor 1, LAIR1, LAIR-1, hLAIR1) (FITC)

Sign In for Pricing
View Details